LOCUS       NC_038892               1096 bp    DNA     linear   VRL 07-SEP-2018
DEFINITION  Banana bunchy top alphasatellite 1 V2 (V2), V1 (V1), C2 (C2), and
            C1 (C1) genes, complete cds.
ACCESSION   NC_038892
VERSION     NC_038892.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Banana bunchy top alphasatellite 1
  ORGANISM  Banana bunchy top alphasatellite 1
            Viruses; Satellites; Satellite Nucleic Acids; Single stranded DNA
            satellites; Alphasatellitidae; Nanoalphasatellitinae;
            Babusatellite.
REFERENCE   1  (bases 1 to 1096)
  AUTHORS   Wu,R.-Y., You,L.-R. and Soong,T.-S.
  TITLE     Nucleotide sequences of two circular single-stranded DNAs
            associated with banana bunchy top virus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1096)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-SEP-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to L32167.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1096
                     /organism="Banana bunchy top alphasatellite 1"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:2169721"
     regulatory      1..7
                     /regulatory_class="TATA_box"
     stem_loop       7..38
     gene            71..928
                     /gene="V2"
                     /locus_tag="D1T17_gp1"
                     /db_xref="GeneID:37784996"
     CDS             71..928
                     /gene="V2"
                     /locus_tag="D1T17_gp1"
                     /codon_start=1
                     /product="V2"
                     /protein_id="YP_009508165.1"
                     /db_xref="GeneID:37784996"
                     /translation="MSSFKWCFTLNYSSAAEREDFLALLKEEDVHYSVVGDEVAPATG
                     QKHLQGYLSLKKSIRLGGLKKKYGSRAHWEIAKGSDEQNRRYCSKETLVLELGTPVVP
                     GSKKRKLLDRFRESPEELKMDDPSKYRRCLAVESIKDARINSEWVHELKEWQNKLIQH
                     IEGVPDDRSIIWVYGPNGGEGKSTFARYLSLKPGWGYINGGKTSDMMHIITMDPDNHW
                     IIDIPRSHSDYLNYGVIEQIKNRVLINTKYEPCVIRKDGQNVHVIVMANVLPDYCKIS
                     EDRIKIINC"
     gene            85..309
                     /gene="V1"
                     /locus_tag="D1T17_gp2"
                     /db_xref="GeneID:37784993"
     CDS             85..309
                     /gene="V1"
                     /locus_tag="D1T17_gp2"
                     /codon_start=1
                     /product="V1"
                     /protein_id="YP_009508166.1"
                     /db_xref="GeneID:37784993"
                     /translation="MVLHSELFLRSGARRLSRSSEGGGCSLLCRRRRSRSGHRPEAPP
                     GISIPEKINSPRRIEKEVWLPCSLGDCERK"
     gene            complement(544..699)
                     /gene="C2"
                     /locus_tag="D1T17_gp3"
                     /db_xref="GeneID:37784994"
     CDS             complement(544..699)
                     /gene="C2"
                     /locus_tag="D1T17_gp3"
                     /codon_start=1
                     /product="C2"
                     /protein_id="YP_009508167.1"
                     /db_xref="GeneID:37784994"
                     /translation="MMCIISDVFPPLIYPHPGFNDRYLAKVDFPSPPLGPYTQMILRS
                     SGTPSMC"
     gene            complement(883..1059)
                     /gene="C1"
                     /locus_tag="D1T17_gp4"
                     /db_xref="GeneID:37784995"
     CDS             complement(883..1059)
                     /gene="C1"
                     /locus_tag="D1T17_gp4"
                     /codon_start=1
                     /product="C1"
                     /protein_id="YP_009508168.1"
                     /db_xref="GeneID:37784995"
                     /translation="MGLRPNKRFINYNDFLMHLMIACSASYRVGSTCFLIACGGSFLS
                     QQLIIFILSSEILQ"
ORIGIN      
        1 tatataagga ggagcggcta gtattacccg ctcctcctcg cacttcctcc tcgcacctga
       61 cgtcatcatt atgtcctctt ttaaatggtg cttcactctg aattattcct ccgcagcgga
      121 gcgagaagac tttctcgctc ttctgaagga ggaggatgtt cactactctg tcgtcggcga
      181 cgaagtcgct ccggccaccg gccagaagca cctccaggga tatctatccc tgaaaaaatc
      241 aattcgcctc ggcggattga aaaagaagta tggctcccgt gctcactggg agattgcgaa
      301 aggaagtgac gaacagaatc gcagatactg ttcgaaggaa accctagttc ttgaactggg
      361 tactccggtg gttcctggtt cgaagaagcg caagcttctc gatagattca gagagagccc
      421 tgaggaattg aagatggacg atccatccaa gtatcgcaga tgcttggcag tggaatcaat
      481 taaagatgcc agaattaatt ccgaatgggt tcacgaacta aaagaatggc aaaataaatt
      541 aattcaacac atcgaaggtg ttcctgatga tcgaagtatc atctgggtat acggtcccaa
      601 cggaggcgaa ggaaagtcaa ccttcgcaag atatctatca ttaaaacccg gatggggata
      661 tatcaacggt ggaaagacgt cggatatgat gcacatcata acgatggatc ctgataatca
      721 ttggattatt gatatcccca gaagtcattc agattatctg aattatggcg ttatagaaca
      781 aattaagaat agagttttaa taaatacaaa atacgaacca tgtgtgatta gaaaagatgg
      841 acaaaatgtc catgtaattg ttatggcaaa tgtgttgcct gattattgta aaatttcaga
      901 agatagaata aaaataatta attgttgaga aaggaaactt cctccgcaag caatcaaaaa
      961 gcacgtggac cccacacggt agcttgcaga acacgctatc attaaatgca tcagaaaatc
     1021 attataatta ataaatctct tattgggccg caggcccatg taaggcccat tacttaatgg
     1081 gccgacctcc tcgcac
//